XANAX99% Alprazolamss, CAS: 28981-97-7

XANAX99% Alprazolamss, CAS: 28981-97-7

skype : anyuo anyuo (at) anyuochem (dot )com Product Name: Alprazolam powder CAS 28981-97-7 Application: Research purpose DeliveryTime: 5-7days PackAge: 1kg/ Aluminum foil bag ProductionCapacity: 500 Kilogram/Month Purity: 99.00% Transportati
Clavulanate Potassium

Clavulanate Potassium

Clavulanate Potassium Chemical name] Potassium(Z)-(2R,5R)-3-(2-hydroxyethylidene)- 7-oxo-4-oxa-1-azabicyclo[ 3.2.0 ]heptane-2-carboxylate [Structural formula]C8H8NO5K [DESCRIPTION]White to slightly yellowish powder. [SPECIFICATIONS] Clavulanat
Clavulanate Potassium

Clavulanate Potassium

Clavulanate Potassium Chemical name] Potassium(Z)-(2R,5R)-3-(2-hydroxyethylidene)- 7-oxo-4-oxa-1-azabicyclo[ 3.2.0 ]heptane-2-carboxylate [Structural formula]C8H8NO5K [DESCRIPTION]White to slightly yellowish powder. [SPECIFICATIONS] Clavulanat
Clavulanate Potassium

Clavulanate Potassium

Clavulanate Potassium Chemical name] Potassium(Z)-(2R,5R)-3-(2-hydroxyethylidene)- 7-oxo-4-oxa-1-azabicyclo[ 3.2.0 ]heptane-2-carboxylate [Structural formula]C8H8NO5K [DESCRIPTION]White to slightly yellowish powder. [SPECIFICATIONS] Clavulanat
Clavulanate Potassium

Clavulanate Potassium

Clavulanate Potassium Chemical name] Potassium(Z)-(2R,5R)-3-(2-hydroxyethylidene)- 7-oxo-4-oxa-1-azabicyclo[ 3.2.0 ]heptane-2-carboxylate [Structural formula]C8H8NO5K [DESCRIPTION]White to slightly yellowish powder. [SPECIFICATIONS] Clavulanat
Clavulanate Potassium

Clavulanate Potassium

Clavulanate Potassium Chemical name] Potassium(Z)-(2R,5R)-3-(2-hydroxyethylidene)- 7-oxo-4-oxa-1-azabicyclo[ 3.2.0 ]heptane-2-carboxylate [Structural formula]C8H8NO5K [DESCRIPTION]White to slightly yellowish powder. [SPECIFICATIONS] Clavulanat
Clavulanate Potassium

Clavulanate Potassium

Clavulanate Potassium Chemical name] Potassium(Z)-(2R,5R)-3-(2-hydroxyethylidene)- 7-oxo-4-oxa-1-azabicyclo[ 3.2.0 ]heptane-2-carboxylate [Structural formula]C8H8NO5K [DESCRIPTION]White to slightly yellowish powder. [SPECIFICATIONS] Clavulanat
Recombinant human C-X-C motif chemokine 13 protein

Recombinant human C-X-C motif chemokine 13 protein

Product Name: Recombinant human C-X-C motif chemokine 13 protein Product Type : Recombinant Protein Code : CSB-RP061394h Size : 1mg Uniprot NO. : O43927 Sequence : VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS Research Area :
Rat Kidney injury molecule 1,Kim-1 ELISA Kit

Rat Kidney injury molecule 1,Kim-1 ELISA Kit

Product Name: Rat Kidney injury molecule 1,Kim-1 ELISA Kit Product Type : ELISA Kit Code : CSB-E08808r Size : 96T,5×96T,10×96T Uniprot NO. : O54947 Abbreviation : Kim-1 Protein Biological Process 1 : others Alias : HAVCR, HAVCR-1, KIM-1, KIM1, TIM-1, T
Human Hepatitis A virus cellular receptor 2 (HAVCR2) ELISA kit

Human Hepatitis A virus cellular receptor 2 (HAVCR2) ELISA kit

Product Name: Human Hepatitis A virus cellular receptor 2(HAVCR2) ELISA kit Product Type : ELISA Kit Code : CSB-EL010145HU Size : 96T,5×96T,10×96T Uniprot NO. : Q8TDQ0 Abbreviation : HAVCR2 Alias : FLJ14428, KIM-3, TIM3, TIMD3, Tim-3, T cell immunoglobu